SCOPe 2.07: Domain d6gfaa2: 6gfa A:191-379

Lineage for d6gfaa2 (6gfa A:191-379)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (63 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224896] (68 PDB entries)

8. Domain d6gfaa2: 6gfa A:191-379 [368550]
   automated match to d3qfua2
   complexed with atp, mg

Details for d6gfaa2

PDB Entry: 6gfa, 2 Å

PDB Description: structure of nucleotide binding domain of hsp110, atp and mg2+ complexed

PDB Compounds: (A:) Heat shock protein 105 kDa

SCOPe Domain Sequences for d6gfaa2:

Sequence; same for both SEQRES and ATOM records:

>d6gfaa2 c.55.1.0 (A:191-379) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dekprivvfvdmghsafqvsacafnkgklkvlgtafdpflggknfdeklvehfcaefktk
ykldakskirallrlyqeceklkklmssnstdlplniecfmndkdvsgkmnrsqfeelca
ellqkievplyslleqthlkvedvsaveivggatripavkeriakffgkdisttlnadea
vargcalqc

Timeline for d6gfaa2:

• d6gfaa2 is new in SCOPe 2.07-stable
  
• d6gfaa2 appears in the current release, SCOPe 2.08