Lineage for d6gfaa2 (6gfa A:191-379)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460924Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2460925Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2462168Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2462169Protein automated matches [226839] (63 species)
    not a true protein
  7. 2462308Species Human (Homo sapiens) [TaxId:9606] [224896] (68 PDB entries)
  8. 3068488Domain d6gfaa2: 6gfa A:191-379 [368550]
    automated match to d3qfua2
    complexed with atp, mg

Details for d6gfaa2

PDB Entry: 6gfa (more details), 2 Å

PDB Description: structure of nucleotide binding domain of hsp110, atp and mg2+ complexed
PDB Compounds: (A:) Heat shock protein 105 kDa

SCOPe Domain Sequences for d6gfaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gfaa2 c.55.1.0 (A:191-379) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dekprivvfvdmghsafqvsacafnkgklkvlgtafdpflggknfdeklvehfcaefktk
ykldakskirallrlyqeceklkklmssnstdlplniecfmndkdvsgkmnrsqfeelca
ellqkievplyslleqthlkvedvsaveivggatripavkeriakffgkdisttlnadea
vargcalqc

SCOPe Domain Coordinates for d6gfaa2:

Click to download the PDB-style file with coordinates for d6gfaa2.
(The format of our PDB-style files is described here.)

Timeline for d6gfaa2:

  • d6gfaa2 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6gfaa1