Lineage for d6ge8a_ (6ge8 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470823Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2470824Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2472162Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2472163Protein automated matches [190151] (140 species)
    not a true protein
  7. 3068474Species Mycobacterium microti [TaxId:1806] [368536] (1 PDB entry)
  8. 3068482Domain d6ge8a_: 6ge8 A: [368544]
    automated match to d4cxqa_
    complexed with ewe, mg

Details for d6ge8a_

PDB Entry: 6ge8 (more details), 1.87 Å

PDB Description: crystal structure of mycobacterium tuberculosis bioa
PDB Compounds: (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase

SCOPe Domain Sequences for d6ge8a_:

Sequence, based on SEQRES records: (download)

>d6ge8a_ c.67.1.0 (A:) automated matches {Mycobacterium microti [TaxId: 1806]}
gltpeqiiavdgahlwhpyssigreavspvvavaahgawltlirdgqpievldamsswwt
aihghghpaldqalttqlrvmnhvmfgglthepaarlakllvditpagldtvffsdsgsv
svevaakmalqywrgrglpgkrrlmtwrggyhgdtflamsicdphggmhslwtdvlaaqv
fapqvprdydpaysaafeaqlaqhagelaavvvepvvqgaggmrfhdprylhdlrdicrr
yevllifdeiatgfgrtgalfaadhagvspdimcvgkaltggylslaatlctadvahtis
agaagalmhgptfmanplacavsvasvelllgqdwrtritelaagltagldtaralpavt
dvrvcgaigviecdrpvdlavatpaaldrgvwlrpfrnlvyamppyictpaeitqitsam
vevarlvg

Sequence, based on observed residues (ATOM records): (download)

>d6ge8a_ c.67.1.0 (A:) automated matches {Mycobacterium microti [TaxId: 1806]}
gltpeqiiavdgahlwhpyssigreavspvvavaahgawltlirdgqpievldamsswwt
aihghghpaldqalttqlrvmnhvmfgglthepaarlakllvditpagldtvffsdsgsv
svevaakmalqywrgrglpgkrrlmtwrggyhgdtflamsicdphggmhlaaqvfapqvp
rdydpaysaafeaqlaqhagelaavvvepvvqgaggmrfhdprylhdlrdicrryevlli
fdeiatgfgrtgalfaadhagvspdimcvgkaltggylslaatlctadvahtisagaaga
lmhgptfmanplacavsvasvelllgqdwrtritelaagltagldtaralpavtdvrvcg
aigviecdrpvdlavatpaaldrgvwlrpfrnlvyamppyictpaeitqitsamvevarl
vg

SCOPe Domain Coordinates for d6ge8a_:

Click to download the PDB-style file with coordinates for d6ge8a_.
(The format of our PDB-style files is described here.)

Timeline for d6ge8a_:

  • d6ge8a_ appears in periodic updates to SCOPe 2.07 starting on 2019-05-09