Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
Domain d6dkjl2: 6dkj L:107-213 [368521] Other proteins in same PDB: d6dkja_, d6dkjb1, d6dkjh_, d6dkjl1 automated match to d1dn0a2 complexed with edo |
PDB Entry: 6dkj (more details), 1.95 Å
SCOPe Domain Sequences for d6dkjl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6dkjl2 b.1.1.2 (L:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]} krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge
Timeline for d6dkjl2:
View in 3D Domains from other chains: (mouse over for more information) d6dkja_, d6dkjb1, d6dkjb2, d6dkjh_ |