Lineage for d6diga2 (6dig A:85-183)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. Protein automated matches [190374] (15 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1239 PDB entries)
  8. Domain d6diga2: 6dig A:85-183 [368517]
    Other proteins in same PDB: d6diga1, d6digb1
    automated match to d5ujta2
    complexed with nag, trs

Details for d6diga2

PDB Entry: 6dig (more details), 2 Å

PDB Description: crystal structure of dqa1*01:02/dqb1*06:02 in complex with a hypocretin peptide
PDB Compounds: (A:) MHC class II HLA-DQ-alpha chain

SCOPe Domain Sequences for d6diga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6diga2 b.1.1.2 (A:85-183) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atnevpevtvfskspvtlgqpntliclvdnifppvvnitwlsngqsvtegvsetsflsks
dhsffkisyltflpsadeiydckvehwgldqpllkhwep

SCOPe Domain Coordinates for d6diga2 are not available.

Timeline for d6diga2:

Domains from same chain:
(mouse over for more information)
d6diga1
Domains from other chains:
(mouse over for more information)
d6digb1, d6digb2