Lineage for d6diga1 (6dig A:2-84)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. Protein automated matches [226842] (5 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [226044] (105 PDB entries)
  8. Domain d6diga1: 6dig A:2-84 [368513]
    Other proteins in same PDB: d6diga2, d6digb2
    automated match to d5ujta1
    complexed with nag, trs

Details for d6diga1

PDB Entry: 6dig (more details), 2 Å

PDB Description: crystal structure of dqa1*01:02/dqb1*06:02 in complex with a hypocretin peptide
PDB Compounds: (A:) MHC class II HLA-DQ-alpha chain

SCOPe Domain Sequences for d6diga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6diga1 d.19.1.0 (A:2-84) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divadhvascgvnlyqfygpsgqythefdgdeqfyvdlerketawrwpefskfggfdpqg
alrnmavakhnlnimikrynsta

SCOPe Domain Coordinates for d6diga1 are not available.

Timeline for d6diga1:

Domains from same chain:
(mouse over for more information)
d6diga2
Domains from other chains:
(mouse over for more information)
d6digb1, d6digb2