SCOPe 2.08: Domain d6dbpa1: 6dbp A:2-84

Lineage for d6dbpa1 (6dbp A:2-84)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188315] (106 PDB entries)

8. Domain d6dbpa1: 6dbp A:2-84 [368508]
   Other proteins in same PDB: d6dbpa2
   automated match to d1d8za_

Details for d6dbpa1

PDB Entry: 6dbp, 1.6 Å

PDB Description: rna-recognition motif 1 of human msi2

PDB Compounds: (A:) RNA-binding protein Musashi homolog 2

SCOPe Domain Sequences for d6dbpa1:

Sequence; same for both SEQRES and ATOM records:

>d6dbpa1 d.58.7.0 (A:2-84) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kmfigglswqtspdslrdyfskfgeirecmvmrdpttkrsrgfgfvtfadpasvdkvlgq
phheldsktidpkvafprraqpk

Timeline for d6dbpa1:

• d6dbpa1 first appeared in SCOPe 2.07, called d6dbpa_