Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.3: Phage lysozyme [53981] (4 proteins) |
Protein Phage T4 lysozyme [53982] (1 species) |
Species Bacteriophage T4 [TaxId:10665] [53983] (570 PDB entries) Uniprot P00720 many mutant structures |
Domain d1c6ea_: 1c6e A: [36850] complexed with bme, cl, xe; mutant |
PDB Entry: 1c6e (more details), 1.9 Å
SCOPe Domain Sequences for d1c6ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c6ea_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]} mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk deaeklfnqdvdaavrgilrnaklkpvydsldavrraaainmvfqmgetgvagftnslrm lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk
Timeline for d1c6ea_: