Lineage for d1c6ea_ (1c6e A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 28759Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 28760Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 29167Family d.2.1.3: Phage T4 lysozyme [53981] (1 protein)
  6. 29168Protein Phage T4 lysozyme [53982] (1 species)
  7. 29169Species Bacteriophage T4 [TaxId:10665] [53983] (336 PDB entries)
  8. 29396Domain d1c6ea_: 1c6e A: [36850]

Details for d1c6ea_

PDB Entry: 1c6e (more details), 1.9 Å

PDB Description: t4 lysozyme mutant c54t/c97a/l99a in the presence of 2 atm xenon

SCOP Domain Sequences for d1c6ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c6ea_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraaainmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk

SCOP Domain Coordinates for d1c6ea_:

Click to download the PDB-style file with coordinates for d1c6ea_.
(The format of our PDB-style files is described here.)

Timeline for d1c6ea_: