Lineage for d6dbha_ (6dbh A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [48525] (168 PDB entries)
    Uniprot P37231 232-505
  8. Domain d6dbha_: 6dbh A: [368499]
    automated match to d3prga_
    protein/DNA complex; complexed with cl, g3s

Details for d6dbha_

PDB Entry: 6dbh (more details), 2.6 Å

PDB Description: crystal structure of ppar gamma in complex with nmp422
PDB Compounds: (A:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d6dbha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dbha_ a.123.1.1 (A:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
npesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikf
khitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvhe
iiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdl
aifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrq
ivtehvqllqvikktetdmslhpllqeiykd

SCOPe Domain Coordinates for d6dbha_ are not available.

Timeline for d6dbha_:

Domains from other chains:
(mouse over for more information)
d6dbhb_