Lineage for d5zstb1 (5zst B:1-384)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470823Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2470824Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2472162Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2472163Protein automated matches [190151] (158 species)
    not a true protein
  7. 3068412Species Hydrogenimonas thermophila [TaxId:223786] [368474] (4 PDB entries)
  8. 3068435Domain d5zstb1: 5zst B:1-384 [368497]
    Other proteins in same PDB: d5zsta2, d5zstb2
    automated match to d5wt5c_

Details for d5zstb1

PDB Entry: 5zst (more details), 3.1 Å

PDB Description: nifs from hydrogenimonas thermopile in a persulfurated form
PDB Compounds: (B:) Cysteine desulfurase

SCOPe Domain Sequences for d5zstb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zstb1 c.67.1.0 (B:1-384) automated matches {Hydrogenimonas thermophila [TaxId: 223786]}
mkvyldnnattivdpevkaamdpyftqiygnpnslhdfgtechpalrkamdqmyeaigar
deddivvtscatesnnwvlkgvyfdlikngdkdhiittevehpsvtatcrwleeqgvrvt
ylpvnqdgvveahtvrdfitdktalvsimwannetgaifpveeiseickekgvlfhtdgv
qaigkipvdviragvdfmsfsahkfhgpkgvgglyirnghpltsllhggehmggrrsgtl
nvpgivgmgkamelatyylkfeeehvrklrdkledaileipdtysvgprenrtpntilvs
vrgvegeamlwdlnragiaastgsacasedleanpimvavgadselahtavrlslsrftt
eeeidytieqfkkaverlrsisss

SCOPe Domain Coordinates for d5zstb1:

Click to download the PDB-style file with coordinates for d5zstb1.
(The format of our PDB-style files is described here.)

Timeline for d5zstb1:

  • d5zstb1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d5zstb2