![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
![]() | Protein automated matches [190151] (166 species) not a true protein |
![]() | Species Hydrogenimonas thermophila [TaxId:223786] [368474] (4 PDB entries) |
![]() | Domain d5zsrb1: 5zsr B:1-385 [368494] Other proteins in same PDB: d5zsra2, d5zsrb2 automated match to d5wt5c_ |
PDB Entry: 5zsr (more details), 2.61 Å
SCOPe Domain Sequences for d5zsrb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zsrb1 c.67.1.0 (B:1-385) automated matches {Hydrogenimonas thermophila [TaxId: 223786]} mkvyldnnattivdpevkaamdpyftqiygnpnslhdfgtechpalrkamdqmyeaigar deddivvtscatesnnwvlkgvyfdlikngdkdhiittevehpsvtatcrwleeqgvrvt ylpvnqdgvveahtvrdfitdktalvsimwannetgaifpveeiseickekgvlfhtdgv qaigkipvdviragvdfmsfsahkfhgpkgvgglyirnghpltsllhggehmggrrsgtl nvpgivgmgkamelatyylkfeeehvrklrdkledaileipdtysvgprenrtpntilvs vrgvegeamlwdlnragiaastgsacasedleanpimvavgadselahtavrlslsrftt eeeidytieqfkkaverlrsisssy
Timeline for d5zsrb1: