Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (160 species) not a true protein |
Species Hydrogenimonas thermophila [TaxId:223786] [368474] (4 PDB entries) |
Domain d5zssb1: 5zss B:1-384 [368485] Other proteins in same PDB: d5zssa2, d5zssb2 automated match to d5wt5c_ complexed with c6p |
PDB Entry: 5zss (more details), 3.17 Å
SCOPe Domain Sequences for d5zssb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zssb1 c.67.1.0 (B:1-384) automated matches {Hydrogenimonas thermophila [TaxId: 223786]} mkvyldnnattivdpevkaamdpyftqiygnpnslhdfgtechpalrkamdqmyeaigar deddivvtscatesnnwvlkgvyfdlikngdkdhiittevehpsvtatcrwleeqgvrvt ylpvnqdgvveahtvrdfitdktalvsimwannetgaifpveeiseickekgvlfhtdgv qaigkipvdviragvdfmsfsahkfhgpkgvgglyirnghpltsllhggehmggrrsgtl nvpgivgmgkamelatyylkfeeehvrklrdkledaileipdtysvgprenrtpntilvs vrgvegeamlwdlnragiaastgsacasedleanpimvavgadselahtavrlslsrftt eeeidytieqfkkaverlrsisss
Timeline for d5zssb1: