SCOPe 2.08: Domain d5zssb1: 5zss B:1-384

Lineage for d5zssb1 (5zss B:1-384)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (166 species)
   not a true protein

7. Species Hydrogenimonas thermophila [TaxId:223786] [368474] (4 PDB entries)

8. Domain d5zssb1: 5zss B:1-384 [368485]
   Other proteins in same PDB: d5zssa2, d5zssb2
   automated match to d5wt5c_
   complexed with c6p

Details for d5zssb1

PDB Entry: 5zss, 3.17 Å

PDB Description: l-cysteine-plp reaction intermediate of nifs from hydrogenimonas thermophila

PDB Compounds: (B:) Cysteine desulfurase

SCOPe Domain Sequences for d5zssb1:

Sequence; same for both SEQRES and ATOM records:

>d5zssb1 c.67.1.0 (B:1-384) automated matches {Hydrogenimonas thermophila [TaxId: 223786]}
mkvyldnnattivdpevkaamdpyftqiygnpnslhdfgtechpalrkamdqmyeaigar
deddivvtscatesnnwvlkgvyfdlikngdkdhiittevehpsvtatcrwleeqgvrvt
ylpvnqdgvveahtvrdfitdktalvsimwannetgaifpveeiseickekgvlfhtdgv
qaigkipvdviragvdfmsfsahkfhgpkgvgglyirnghpltsllhggehmggrrsgtl
nvpgivgmgkamelatyylkfeeehvrklrdkledaileipdtysvgprenrtpntilvs
vrgvegeamlwdlnragiaastgsacasedleanpimvavgadselahtavrlslsrftt
eeeidytieqfkkaverlrsisss

Timeline for d5zssb1:

• d5zssb1 first appeared in SCOPe 2.07