Lineage for d5zspa1 (5zsp A:1-386)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2897322Species Hydrogenimonas thermophila [TaxId:223786] [368474] (4 PDB entries)
  8. 2897323Domain d5zspa1: 5zsp A:1-386 [368477]
    Other proteins in same PDB: d5zspa2, d5zspb2
    automated match to d5wt5c_

Details for d5zspa1

PDB Entry: 5zsp (more details), 2.57 Å

PDB Description: nifs from hydrogenimonas thermophila
PDB Compounds: (A:) Cysteine desulfurase

SCOPe Domain Sequences for d5zspa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zspa1 c.67.1.0 (A:1-386) automated matches {Hydrogenimonas thermophila [TaxId: 223786]}
mkvyldnnattivdpevkaamdpyftqiygnpnslhdfgtechpalrkamdqmyeaigar
deddivvtscatesnnwvlkgvyfdlikngdkdhiittevehpsvtatcrwleeqgvrvt
ylpvnqdgvveahtvrdfitdktalvsimwannetgaifpveeiseickekgvlfhtdgv
qaigkipvdviragvdfmsfsahkfhgpkgvgglyirnghpltsllhggehmggrrsgtl
nvpgivgmgkamelatyylkfeeehvrklrdkledaileipdtysvgprenrtpntilvs
vrgvegeamlwdlnragiaastgsacasedleanpimvavgadselahtavrlslsrftt
eeeidytieqfkkaverlrsisssya

SCOPe Domain Coordinates for d5zspa1:

Click to download the PDB-style file with coordinates for d5zspa1.
(The format of our PDB-style files is described here.)

Timeline for d5zspa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5zspa2