![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
![]() | Protein automated matches [190151] (166 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:224308] [320074] (13 PDB entries) |
![]() | Domain d5zsoa_: 5zso A: [368471] automated match to d5ft6a_ complexed with c6p, peg |
PDB Entry: 5zso (more details), 2.7 Å
SCOPe Domain Sequences for d5zsoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zsoa_ c.67.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]} mnitdireqfpilhqqvnghdlvyldsaatsqkpravietldkyynqynsnvhrgvhtlg tratdgyegarekvrkfinaksmaeiiftkgtttslnmvalsyaranlkpgdevvityme hhaniipwqqavkatgatlkyiplqedgtisledvretvtsntkivavshvsnvlgtvnp ikemakiahdngavivvdgaqstphmkidvqdldcdffalsshkmcgptgvgvlygkkal lenmepaefggemidfvglyestwkelpwkfeagtpiiagaiglgaaidfleeigldeis rhehklaayalerfrqldgvtvygpeeraglvtfnlddvhphdvatvldaegiavraghh caqplmkwldvtatarasfylynteeeidklvealqktkeyftnv
Timeline for d5zsoa_: