Lineage for d6onaa1 (6ona A:3-324)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2370814Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2370815Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2371474Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2371475Protein automated matches [227017] (47 species)
    not a true protein
  7. 3068383Species Influenza a virus (strain a/hickox/1940 h1n1) [TaxId:383543] [368445] (1 PDB entry)
  8. 3068405Domain d6onaa1: 6ona A:3-324 [368467]
    Other proteins in same PDB: d6onaa2, d6onaa3, d6onab2, d6onab3, d6onac2, d6onac3
    automated match to d4wsrd1
    complexed with bma, cl, nag, peg

Details for d6onaa1

PDB Entry: 6ona (more details), 1.95 Å

PDB Description: crystal structure of influenza hemagglutinin from strain a/hickox/jy2/1940
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d6onaa1:

Sequence, based on SEQRES records: (download)

>d6onaa1 b.19.1.0 (A:3-324) automated matches {Influenza a virus (strain a/hickox/1940 h1n1) [TaxId: 383543]}
dticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcniagw
ilgnpecesllskrswsyiaetpnsengtcypgdfadyeelreqlssvssferfeifpke
rswpnhninigvtaacshagkssfyknllwltekdgsypnlnksyvnkkekevlvlwgvh
hpsnienqktlyrkenayvsvvssnynrrftpeiaerpkvrgqagrmnyywtllepgdti
ifeangnliapwyafalsrglgsgiitsnasmdecdtkcqtpqgainsslpfqnihpfti
gecpkyvrstklrmvtglrnip

Sequence, based on observed residues (ATOM records): (download)

>d6onaa1 b.19.1.0 (A:3-324) automated matches {Influenza a virus (strain a/hickox/1940 h1n1) [TaxId: 383543]}
dticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcniagw
ilgnpeceslrswsyiaetpnsengtcypgdfadyeelreqlssvssferfeifpkersw
pnhninigvtaacshagkssfyknllwltekdgsypnlnksyvnkkekevlvlwgvhhps
nienqktlyrkenayvsvvssnynrrftpeiaerpkvrgqagrmnyywtllepgdtiife
angnliapwyafalsrglgsgiitsnasmdecdtkcqtpqgainsslpfqnihpftigec
pkyvrstklrmvtglrnip

SCOPe Domain Coordinates for d6onaa1:

Click to download the PDB-style file with coordinates for d6onaa1.
(The format of our PDB-style files is described here.)

Timeline for d6onaa1: