Lineage for d6q82b_ (6q82 B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2447791Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2448557Protein Ran [52609] (2 species)
  7. 2448578Species Human (Homo sapiens) [TaxId:9606] [52611] (65 PDB entries)
  8. 3068397Domain d6q82b_: 6q82 B: [368459]
    automated match to d3ea5a_
    complexed with gtp, mg

Details for d6q82b_

PDB Entry: 6q82 (more details), 2.99 Å

PDB Description: crystal structure of the biportin pdr6 in complex with rangtp
PDB Compounds: (B:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d6q82b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6q82b_ c.37.1.8 (B:) Ran {Human (Homo sapiens) [TaxId: 9606]}
qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
glekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefva

SCOPe Domain Coordinates for d6q82b_:

Click to download the PDB-style file with coordinates for d6q82b_.
(The format of our PDB-style files is described here.)

Timeline for d6q82b_: