Lineage for d6onna1 (6onn A:1-394)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470823Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2470824Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2472162Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2472163Protein automated matches [190151] (143 species)
    not a true protein
  7. 3068392Species Paraburkholderia phymatum [TaxId:391038] [368454] (1 PDB entry)
  8. 3068393Domain d6onna1: 6onn A:1-394 [368455]
    Other proteins in same PDB: d6onna2, d6onnb2
    automated match to d5vnxa_

Details for d6onna1

PDB Entry: 6onn (more details), 1.8 Å

PDB Description: crystal structure of 8-amino-7-oxononanoate synthase from burkholderia phymatum
PDB Compounds: (A:) 8-amino-7-oxononanoate synthase

SCOPe Domain Sequences for d6onna1:

Sequence, based on SEQRES records: (download)

>d6onna1 c.67.1.0 (A:1-394) automated matches {Paraburkholderia phymatum [TaxId: 391038]}
mqlldtleqglkeidarglrrrrrtvdspcsahmtvdgrnmigfasndylglaahpllva
aitegarrygagsggshllgghsrahaqleddlaefaggfvdnpralyfstgymanlatl
talagrgttlfsdslnhaslidgarlsradiqiyphadaealgamleasdaavklivsdt
vfsmdgdiaplarllelaehhgawlvvddahgfgvlgpqgrgavaeaalrsphlivvgtl
gkaagvsgafvvahetviewlvqrarpyifttasvpsaahavsaslriiggdegehrrah
lrslialtrdmlkstpwlpvdshtavqpliigsneatldvaasldranlwvpairpptvp
egtsrlrislsaahshndleqlehalmktaeara

Sequence, based on observed residues (ATOM records): (download)

>d6onna1 c.67.1.0 (A:1-394) automated matches {Paraburkholderia phymatum [TaxId: 391038]}
mqlldtleqglkeidarglrrrrrtvdspcsahmtvdgrnmigfasndylglaahpllva
aitegarrygagsgghsrahaqleddlaefaggfvdnpralyfstgymanlatltalagr
gttlfsdslnhaslidgarlsradiqiyphadaealgamleasdaavklivsdtvfsmdg
diaplarllelaehhgawlvvddahgfgvlgpqgrgavaeaalrsphlivvgtlgkaagv
sgafvvahetviewlvqrarpyifttasvpsaahavsaslriiggdegehrrahlrslia
ltrdmlkstpwlpvdshtavqpliigsneatldvaasldranlwvpairpptvpegtsrl
rislsaahshndleqlehalmktaeara

SCOPe Domain Coordinates for d6onna1:

Click to download the PDB-style file with coordinates for d6onna1.
(The format of our PDB-style files is described here.)

Timeline for d6onna1:

  • d6onna1 appears in periodic updates to SCOPe 2.07 starting on 2019-05-02

View in 3D
Domains from same chain:
(mouse over for more information)
d6onna2