Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins) contains a catalytic triad or dyad different from the class I GAT triad |
Protein automated matches [190995] (9 species) not a true protein |
Species Pyrococcus furiosus [TaxId:2261] [368442] (1 PDB entry) |
Domain d6q3ta_: 6q3t A: [368450] automated match to d1g2ia_ |
PDB Entry: 6q3t (more details), 2.15 Å
SCOPe Domain Sequences for d6q3ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6q3ta_ c.23.16.2 (A:) automated matches {Pyrococcus furiosus [TaxId: 2261]} mkvlfltanefedveliypyhrlkeeghavyiasfergtitgkhgysvkvdltfdkvnpa efdalvlpggrapervrlnakavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk
Timeline for d6q3ta_: