Lineage for d6q3ta_ (6q3t A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2467009Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2467192Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins)
    contains a catalytic triad or dyad different from the class I GAT triad
  6. 2467350Protein automated matches [190995] (9 species)
    not a true protein
  7. 2467363Species Pyrococcus furiosus [TaxId:2261] [368442] (1 PDB entry)
  8. 2467364Domain d6q3ta_: 6q3t A: [368450]
    automated match to d1g2ia_

Details for d6q3ta_

PDB Entry: 6q3t (more details), 2.15 Å

PDB Description: structure of protease1 from pyrococcus horikoshii at room temperature in chipx microfluidic device
PDB Compounds: (A:) Protease1

SCOPe Domain Sequences for d6q3ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6q3ta_ c.23.16.2 (A:) automated matches {Pyrococcus furiosus [TaxId: 2261]}
mkvlfltanefedveliypyhrlkeeghavyiasfergtitgkhgysvkvdltfdkvnpa
efdalvlpggrapervrlnakavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk

SCOPe Domain Coordinates for d6q3ta_:

Click to download the PDB-style file with coordinates for d6q3ta_.
(The format of our PDB-style files is described here.)

Timeline for d6q3ta_: