SCOPe 2.07: Domain d6j3pa_: 6j3p A:

Lineage for d6j3pa_ (6j3p A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.1: Bromodomain [47371] (6 proteins)

6. Protein automated matches [190366] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187201] (67 PDB entries)

8. Domain d6j3pa_: 6j3p A: [368418]
   automated match to d1b91a_
   complexed with b8o

Details for d6j3pa_

PDB Entry: 6j3p, 1.6 Å

PDB Description: crystal structure of the human gcn5 bromodomain in complex with compound (r,r)-36n

PDB Compounds: (A:) Histone acetyltransferase KAT2A

SCOPe Domain Sequences for d6j3pa_:

Sequence; same for both SEQRES and ATOM records:

>d6j3pa_ a.29.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpdqlyttlknllaqikshpsawpfmepvkkseapdyyevirfpidlktmterlrsryyv
trklfvadlqrviancreynppdseycrcasalekffyfklkegglid

Timeline for d6j3pa_:

• d6j3pa_ is new in SCOPe 2.07-stable
  
• d6j3pa_ appears in the current release, SCOPe 2.08