Lineage for d6j3oa_ (6j3o A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319937Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2319938Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2319939Family a.29.2.1: Bromodomain [47371] (6 proteins)
  6. 2320024Protein automated matches [190366] (2 species)
    not a true protein
  7. 2320025Species Human (Homo sapiens) [TaxId:9606] [187201] (67 PDB entries)
  8. 2320137Domain d6j3oa_: 6j3o A: [368416]
    automated match to d1b91a_
    complexed with b4l

Details for d6j3oa_

PDB Entry: 6j3o (more details), 2.11 Å

PDB Description: crystal structure of the human pcaf bromodomain in complex with compound 12
PDB Compounds: (A:) Histone acetyltransferase KAT2B

SCOPe Domain Sequences for d6j3oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6j3oa_ a.29.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktmserlknryyvsk
klfmadlqrvftnckeynppeseyykcanilekfffskikeaglid

SCOPe Domain Coordinates for d6j3oa_:

Click to download the PDB-style file with coordinates for d6j3oa_.
(The format of our PDB-style files is described here.)

Timeline for d6j3oa_: