SCOPe 2.08: Domain d6i8ta2: 6i8t A:797-1009

Lineage for d6i8ta2 (6i8t A:797-1009)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.0: automated matches [191650] (1 protein)
   not a true family

6. Protein automated matches [191197] (13 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [368395] (2 PDB entries)

8. Domain d6i8ta2: 6i8t A:797-1009 [368410]
   Other proteins in same PDB: d6i8ta1
   automated match to d4hhyd2
   protein/DNA complex; complexed with h7z

Details for d6i8ta2

PDB Entry: 6i8t, 2.1 Å

PDB Description: the catalytic fragment of poly(adp-ribose) polymerase complexed with an isoindolinone inhibitor

PDB Compounds: (A:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d6i8ta2:

Sequence; same for both SEQRES and ATOM records:

>d6i8ta2 d.166.1.0 (A:797-1009) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
lrtdikvvdkdseeakiikqyvknthaathnaydlkvveifrieregesqrykpfkqlhn
rqllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqadpi
glillgevalgnmyelknashitklpkgkhsvkglgktapdptatttldgvevplgngis
tgindtcllyneyivydvaqvnlkyllklkfny

Timeline for d6i8ta2:

• d6i8ta2 first appeared in SCOPe 2.07