Lineage for d6i8ta2 (6i8t A:797-1009)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558127Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2558128Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2558416Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 2558417Protein automated matches [191197] (11 species)
    not a true protein
  7. 3068333Species Gallus gallus [TaxId:9031] [368395] (2 PDB entries)
  8. 3068348Domain d6i8ta2: 6i8t A:797-1009 [368410]
    Other proteins in same PDB: d6i8ta1
    automated match to d4hhyd2
    protein/DNA complex; complexed with h7z

Details for d6i8ta2

PDB Entry: 6i8t (more details), 2.1 Å

PDB Description: the catalytic fragment of poly(adp-ribose) polymerase complexed with an isoindolinone inhibitor
PDB Compounds: (A:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d6i8ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i8ta2 d.166.1.0 (A:797-1009) automated matches {Gallus gallus [TaxId: 9031]}
lrtdikvvdkdseeakiikqyvknthaathnaydlkvveifrieregesqrykpfkqlhn
rqllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqadpi
glillgevalgnmyelknashitklpkgkhsvkglgktapdptatttldgvevplgngis
tgindtcllyneyivydvaqvnlkyllklkfny

SCOPe Domain Coordinates for d6i8ta2:

Click to download the PDB-style file with coordinates for d6i8ta2.
(The format of our PDB-style files is described here.)

Timeline for d6i8ta2:

  • d6i8ta2 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6i8ta1