![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily) core: 4 helices: bundle; unusual topology |
![]() | Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) ![]() duplication: consists of 2 helix-loop-helix structural repeats automatically mapped to Pfam PF02877 |
![]() | Family a.41.1.0: automated matches [227223] (1 protein) not a true family |
![]() | Protein automated matches [226964] (2 species) not a true protein |
![]() | Species Gallus gallus [TaxId:9031] [368393] (2 PDB entries) |
![]() | Domain d6i8ta1: 6i8t A:662-796 [368409] Other proteins in same PDB: d6i8ta2 automated match to d4hhyd1 protein/DNA complex; complexed with h7z |
PDB Entry: 6i8t (more details), 2.1 Å
SCOPe Domain Sequences for d6i8ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6i8ta1 a.41.1.0 (A:662-796) automated matches {Gallus gallus [TaxId: 9031]} ksklakpiqdlikmifdvesmkkamvefeidlqkmplgklskrqiqsaysilnevqqavs dggsesqildlsnrfytliphdfgmkkppllsnleyiqakvqmldnlldievaysllrgg nedgdkdpidinyek
Timeline for d6i8ta1: