Lineage for d6i8ta1 (6i8t A:662-796)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712204Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
    core: 4 helices: bundle; unusual topology
  4. 2712205Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) (S)
    duplication: consists of 2 helix-loop-helix structural repeats
    automatically mapped to Pfam PF02877
  5. 2712230Family a.41.1.0: automated matches [227223] (1 protein)
    not a true family
  6. 2712231Protein automated matches [226964] (2 species)
    not a true protein
  7. 2712232Species Chicken (Gallus gallus) [TaxId:9031] [368393] (2 PDB entries)
  8. 2712234Domain d6i8ta1: 6i8t A:662-796 [368409]
    Other proteins in same PDB: d6i8ta2
    automated match to d4hhyd1
    protein/DNA complex; complexed with h7z

Details for d6i8ta1

PDB Entry: 6i8t (more details), 2.1 Å

PDB Description: the catalytic fragment of poly(adp-ribose) polymerase complexed with an isoindolinone inhibitor
PDB Compounds: (A:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d6i8ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i8ta1 a.41.1.0 (A:662-796) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
ksklakpiqdlikmifdvesmkkamvefeidlqkmplgklskrqiqsaysilnevqqavs
dggsesqildlsnrfytliphdfgmkkppllsnleyiqakvqmldnlldievaysllrgg
nedgdkdpidinyek

SCOPe Domain Coordinates for d6i8ta1:

Click to download the PDB-style file with coordinates for d6i8ta1.
(The format of our PDB-style files is described here.)

Timeline for d6i8ta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6i8ta2