SCOPe 2.05: Domain d1l73a_: 1l73 A:

Lineage for d1l73a_ (1l73 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.3: Phage lysozyme [53981] (4 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (546 PDB entries)
   Uniprot P00720
   many mutant structures

8. Domain d1l73a_: 1l73 A: [36840]
   complexed with bme, cl

Details for d1l73a_

PDB Entry: 1l73, 1.85 Å

PDB Description: multiple stabilizing alanine replacements within alpha-helix 126-134 of t4 lysozyme have independent, additive effects on both structure and stability

PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d1l73a_:

Sequence; same for both SEQRES and ATOM records:

>d1l73a_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslrm
lqqkrwaaaaaalaksrwynqtpnrakrvittfrtgtwdayk

Timeline for d1l73a_:

• d1l73a_ first appeared (with stable ids) in SCOP 1.55, called d1l73__
  
• d1l73a_ appears in SCOPe 2.04
  
• d1l73a_ appears in SCOPe 2.06
  
• d1l73a_ appears in the current release, SCOPe 2.08