Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Focal adhesion kinase 1 (fak) [103292] (2 species) PTK group; FAK subfamily; non-membrane spanning protein tyrosine kinase |
Species Chicken (Gallus gallus) [TaxId:9031] [187336] (5 PDB entries) |
Domain d6gcxa_: 6gcx A: [368399] automated match to d2j0la_ complexed with euw, so4 |
PDB Entry: 6gcx (more details), 1.55 Å
SCOPe Domain Sequences for d6gcxa_:
Sequence, based on SEQRES records: (download)
>d6gcxa_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Chicken (Gallus gallus) [TaxId: 9031]} rdyeiqrerielgrcigegqfgdvhqgiymspenpamavaiktcknctsdsvrekflqea ltmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkfsldlaslilyayqlst alayleskrfvhrdiaarnvlvsatdcvklgdfglsrymedstyykaskgklpikwmape sinfrrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppncpptly slmtkcwaydpsrrprftelkaqlstileeeklq
>d6gcxa_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Chicken (Gallus gallus) [TaxId: 9031]} rdyeiqrerielgrcigegqfgdvhqgiymspenpamavaiktcknsdsvrekflqealt mrqfdhphivkligvitenpvwiimelctlgelrsflqvrkfsldlaslilyayqlstal ayleskrfvhrdiaarnvlvsatdcvklgdfglsrlpikwmapesinfrrftsasdvwmf gvcmweilmhgvkpfqgvknndvigriengerlpmppncpptlyslmtkcwaydpsrrpr ftelkaqlstileeeklq
Timeline for d6gcxa_: