SCOPe 2.07: Domain d6e9id1: 6e9i D:2-112

Lineage for d6e9id1 (6e9i D:2-112)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226022] (16 PDB entries)

8. Domain d6e9id1: 6e9i D:2-112 [368387]
   automated match to d4k3el1

Details for d6e9id1

PDB Entry: 6e9i, 2.5 Å

PDB Description: the crystal structure of bovine ultralong antibody bov-4

PDB Compounds: (D:) Bovine ultralong antibody BOV-4 light chain

SCOPe Domain Sequences for d6e9id1:

Sequence; same for both SEQRES and ATOM records:

>d6e9id1 b.1.1.0 (D:2-112) automated matches {Cow (Bos taurus) [TaxId: 9913]}
avlnqpssvsgslgqrvsitcsgsssnvgngyvswyqlipgsaprtliygdtsrasgvpd
rfsgsrsgntatltisslqaedeadyfcasaedsssnavfgsgttltvlg

Timeline for d6e9id1:

• d6e9id1 is new in SCOPe 2.07-stable
  
• d6e9id1 appears in the current release, SCOPe 2.08