SCOPe 2.07: Domain d6d9rb1: 6d9r B:1-179

Lineage for d6d9rb1 (6d9r B:1-179)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (38 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [259286] (5 PDB entries)

8. Domain d6d9rb1: 6d9r B:1-179 [368368]
   Other proteins in same PDB: d6d9ra2, d6d9rb2
   automated match to d4rqba_
   complexed with 9dg, act, edo, mg, peg, prp

Details for d6d9rb1

PDB Entry: 6d9r, 1.64 Å

PDB Description: the substrate-bound crystal structure of hprt (hypoxanthine phosphoribosyltransferase)

PDB Compounds: (B:) hypoxanthine phosphoribosyltransferase

SCOPe Domain Sequences for d6d9rb1:

Sequence, based on SEQRES records:

>d6d9rb1 c.61.1.0 (B:1-179) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mmnqdiekvliseeqiqekvlelgaiiaedykntvplaigvlkgampfmadllkrtdtyl
emdfmavssyghstvstgevkilkdldtsvegrdilivediidsgltlsylvdlfkyrka
ksvkivtlldkptgrkvdlkadyvgftvphefvvgygldykeqyrnlpyvgvlkpsvys

Sequence, based on observed residues (ATOM records):

>d6d9rb1 c.61.1.0 (B:1-179) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mmnqdiekvliseeqiqekvlelgaiiaedykntvplaigvlkgampfmadllkrtdtyl
emdfmavsstgevkilkdldtsvegrdilivediidsgltlsylvdlfkyrkaksvkivt
lldkptgrkvdlkadyvgftvphefvvgygldykeqyrnlpyvgvlkpsvys

Timeline for d6d9rb1:

• d6d9rb1 is new in SCOPe 2.07-stable
  
• d6d9rb1 appears in the current release, SCOPe 2.08