SCOPe 2.08: Domain d6e9kb1: 6e9k B:2-112

Lineage for d6e9kb1 (6e9k B:2-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226022] (18 PDB entries)

8. Domain d6e9kb1: 6e9k B:2-112 [368360]
   automated match to d4k3el1

Details for d6e9kb1

PDB Entry: 6e9k, 2.19 Å

PDB Description: the crystal structure of bovine ultralong antibody bov-5

PDB Compounds: (B:) IGL@ protein

SCOPe Domain Sequences for d6e9kb1:

Sequence; same for both SEQRES and ATOM records:

>d6e9kb1 b.1.1.0 (B:2-112) automated matches {Cow (Bos taurus) [TaxId: 9913]}
avlnqpssvsgslgqrvsitcsgsssnvgngyvswyqlipgsaprtliygdtsrasgvpd
rfsgsrsgntatltisslqaedeadyfcasaedsssnavfgsgttltvlg

Timeline for d6e9kb1:

• d6e9kb1 first appeared in SCOPe 2.07