Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226022] (16 PDB entries) |
Domain d6e9il2: 6e9i L:113-216 [368359] automated match to d4k3dl2 |
PDB Entry: 6e9i (more details), 2.5 Å
SCOPe Domain Sequences for d6e9il2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6e9il2 b.1.1.0 (L:113-216) automated matches {Cow (Bos taurus) [TaxId: 9913]} qpksppsvtlfppsteelngnkatlvclisdfypgsvtvvwkadgstitrnvettraskq snskyaassylsltssdwkskgsyscevthegstvtktvkpsec
Timeline for d6e9il2:
View in 3D Domains from other chains: (mouse over for more information) d6e9ib1, d6e9ib2, d6e9id1, d6e9id2 |