Lineage for d6d4ib2 (6d4i B:340-444)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (17 species)
    not a true protein
  7. 2354658Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226134] (25 PDB entries)
  8. 3068288Domain d6d4ib2: 6d4i B:340-444 [368350]
    automated match to d1hzhh4
    complexed with bma, fuc, man, nag

Details for d6d4ib2

PDB Entry: 6d4i (more details), 2.95 Å

PDB Description: crystal structure of a fc fragment of rhesus macaque (macaca mulatta) igg2
PDB Compounds: (B:) Fc fragment of IgG2

SCOPe Domain Sequences for d6d4ib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d4ib2 b.1.1.2 (B:340-444) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
kgqprepqvytlpppreeltknqvsltclvkgfypsdivvewasngqpentykttppvld
sdgsyflyskltvdksrwqqgntfscsvmhealhnhytqkslsls

SCOPe Domain Coordinates for d6d4ib2:

Click to download the PDB-style file with coordinates for d6d4ib2.
(The format of our PDB-style files is described here.)

Timeline for d6d4ib2:

  • d6d4ib2 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6d4ib1