Lineage for d6c9ra1 (6c9r A:1-324)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. Protein automated matches [190117] (50 species)
    not a true protein
  7. Species Mycobacterium tuberculosis [TaxId:1773] [193352] (12 PDB entries)
  8. Domain d6c9ra1: 6c9r A:1-324 [368331]
    Other proteins in same PDB: d6c9ra2, d6c9rb2
    automated match to d4pvva_
    complexed with erj, gol, na

Details for d6c9ra1

PDB Entry: 6c9r (more details), 2.1 Å

PDB Description: mycobacterium tuberculosis adenosine kinase bound to (2r,3s,4r,5r)-2- (hydroxymethyl)-5-(6-(thiophen-3-yl)-9h-purin-9-yl)tetrahydrofuran-3, 4-diol
PDB Compounds: (A:) adenosine kinase

SCOPe Domain Sequences for d6c9ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c9ra1 c.72.1.0 (A:1-324) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mtiavtgsiatdhlmrfpgrfseqllpehlhkvslsflvddlvmhrggvagnmafaigvl
ggevalvgaagadfadyrdwlkargvncdhvlisetahtarftcttdvdmaqiasfypga
msearnikladvvsaigkpelviigandpeamflhteecrklglafaadpsqqlarlsge
eirrlvngaaylftndyewdlllsktgwseadvmaqidlrvttlgpkgvdlvepdgttih
vgvvpetsqtdptgvgdafragfltgrsaglglersaqlgslvavlvlestgtqewqwdy
eaaasrlagaygehaaaeivavla

SCOPe Domain Coordinates for d6c9ra1 are not available.

Timeline for d6c9ra1:

Domains from same chain:
(mouse over for more information)
d6c9ra2
Domains from other chains:
(mouse over for more information)
d6c9rb1, d6c9rb2