Lineage for d6d9ra1 (6d9r A:1-179)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. Protein automated matches [190891] (38 species)
    not a true protein
  7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [259286] (5 PDB entries)
  8. Domain d6d9ra1: 6d9r A:1-179 [368328]
    Other proteins in same PDB: d6d9ra2, d6d9rb2
    automated match to d4rqba_
    complexed with 9dg, act, edo, mg, peg, prp

Details for d6d9ra1

PDB Entry: 6d9r (more details), 1.6400000000000001 Å

PDB Description: the substrate-bound crystal structure of hprt (hypoxanthine phosphoribosyltransferase)
PDB Compounds: (A:) hypoxanthine phosphoribosyltransferase

SCOPe Domain Sequences for d6d9ra1:

Sequence, based on SEQRES records: (download)

>d6d9ra1 c.61.1.0 (A:1-179) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mmnqdiekvliseeqiqekvlelgaiiaedykntvplaigvlkgampfmadllkrtdtyl
emdfmavssyghstvstgevkilkdldtsvegrdilivediidsgltlsylvdlfkyrka
ksvkivtlldkptgrkvdlkadyvgftvphefvvgygldykeqyrnlpyvgvlkpsvys

Sequence, based on observed residues (ATOM records): (download)

>d6d9ra1 c.61.1.0 (A:1-179) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mmnqdiekvliseeqiqekvlelgaiiaedykntvplaigvlkgampfmadllkrtdtyl
emdfmavsstgevkilkdldtsvegrdilivediidsgltlsylvdlfkyrkaksvkivt
lldkptgrkvdlkadyvgftvphefvvgygldykeqyrnlpyvgvlkpsvys

SCOPe Domain Coordinates for d6d9ra1 are not available.

Timeline for d6d9ra1:

Domains from same chain:
(mouse over for more information)
d6d9ra2
Domains from other chains:
(mouse over for more information)
d6d9rb1, d6d9rb2