Lineage for d6d4wa_ (6d4w A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. Family c.1.5.0: automated matches [227276] (1 protein)
    not a true family
  6. Protein automated matches [227084] (15 species)
    not a true protein
  7. Species Mycobacterium thermoresistibile [TaxId:1078020] [324215] (11 PDB entries)
  8. Domain d6d4wa_: 6d4w A: [368318]
    automated match to d4zqra_
    complexed with fwj, imp

Details for d6d4wa_

PDB Entry: 6d4w (more details), 1.8 Å

PDB Description: m. thermoresistible guab2 delta-cbs in complex with inhibitor compound 35 (vcc620637)
PDB Compounds: (A:) Inosine-5'-monophosphate dehydrogenase,Inosine-5'-monophosphate dehydrogenase

SCOPe Domain Sequences for d6d4wa_:

Sequence, based on SEQRES records: (download)

>d6d4wa_ c.1.5.0 (A:) automated matches {Mycobacterium thermoresistibile [TaxId: 1078020]}
vptggddptkiamlgltfddvlllpaasdvlpanadtssqltkkirlkvplvssamdtvt
earmaiamaraggmgvlhrnlpvaeqaaqvetvkrsggllvgaavgvgddaweramalrd
agvdvlvvdtahahnrkvldmvhrlkttvgdeievvggnvatraaaaalveagadavkvg
vgpgsicttrvvagvgapqitaileavaacaphgvpviadgglqysgdiakalaagasta
mlgsllagtaespgelilvngkqfksyrgmgslgamqgrggaksyskdryfqddalsedk
lvpegiegrvpfrgplstvihqlvgglraamgytgsatieelqqaqfvqitaag

Sequence, based on observed residues (ATOM records): (download)

>d6d4wa_ c.1.5.0 (A:) automated matches {Mycobacterium thermoresistibile [TaxId: 1078020]}
vptggddptkiamlgltfddvlllpaasdvlpanadtssqltkkirlkvplvssamdtvt
earmaiamaraggmgvlhrnlpvaeqaaqvetvkrsggllvgaavgvgddaweramalrd
agvdvlvvdtahahnrkvldmvhrlkttvgdeievvggnvatraaaaalveagadavkvg
vgpgsicttrvvagvgapqitaileavaacaphgvpviadgglqysgdiakalaagasta
mlgsllagtaespgelilvngkqfksyrgmgslgamqlvpegiegrvpfrgplstvihql
vgglraamgytgsatieelqqaqfvqitaag

SCOPe Domain Coordinates for d6d4wa_ are not available.

Timeline for d6d4wa_: