Lineage for d5zrpa_ (5zrp A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971788Family d.113.1.0: automated matches [191580] (1 protein)
    not a true family
  6. 2971789Protein automated matches [191036] (17 species)
    not a true protein
  7. 2971929Species Mycobacterium smegmatis [TaxId:246196] [368261] (8 PDB entries)
  8. 2971940Domain d5zrpa_: 5zrp A: [368280]
    automated match to d3eeua_

Details for d5zrpa_

PDB Entry: 5zrp (more details), 1.74 Å

PDB Description: m. smegmatis antimutator protein mutt2 form 3
PDB Compounds: (A:) Putative mutator protein MutT2/NUDIX hydrolase

SCOPe Domain Sequences for d5zrpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zrpa_ d.113.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
kqivvagalisrgtllvaqrdrpaelaglwelpggkvtpgesdadalarelreelgvdva
vgerlgadvalndamtlrayrvtlrsgsphphdhralrwvgadeidglawvpadrawvpd
lvaalsgr

SCOPe Domain Coordinates for d5zrpa_:

Click to download the PDB-style file with coordinates for d5zrpa_.
(The format of our PDB-style files is described here.)

Timeline for d5zrpa_: