Lineage for d1l34__ (1l34 -)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 76064Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 76065Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 76503Family d.2.1.3: Phage T4 lysozyme [53981] (1 protein)
  6. 76504Protein Phage T4 lysozyme [53982] (1 species)
  7. 76505Species Bacteriophage T4 [TaxId:10665] [53983] (348 PDB entries)
  8. 76722Domain d1l34__: 1l34 - [36828]

Details for d1l34__

PDB Entry: 1l34 (more details), 1.9 Å

PDB Description: high-resolution structure of the temperature-sensitive mutant of phage lysozyme, arg 96 (right arrow) his

SCOP Domain Sequences for d1l34__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l34__ d.2.1.3 (-) Phage T4 lysozyme {Bacteriophage T4}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrhcalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl

SCOP Domain Coordinates for d1l34__:

Click to download the PDB-style file with coordinates for d1l34__.
(The format of our PDB-style files is described here.)

Timeline for d1l34__: