Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest |
Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) |
Family c.60.1.0: automated matches [196988] (1 protein) not a true family |
Protein automated matches [196989] (16 species) not a true protein |
Species Entamoeba histolytica [TaxId:885318] [367266] (2 PDB entries) |
Domain d5zr2c_: 5zr2 C: [368263] automated match to d4ij6a_ complexed with peg, pg4, sep, so4; mutant |
PDB Entry: 5zr2 (more details), 2.95 Å
SCOPe Domain Sequences for d5zr2c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zr2c_ c.60.1.0 (C:) automated matches {Entamoeba histolytica [TaxId: 885318]} mtkliliragetewnllgkiqgctdieltpngiqqanevaqqikgnfdiiyssplhrali taqkiagdkevhliegmkeipfgtweghtfeelngdinykkflsgedgcpfdstgmsias wskknaqllldlckqnenktivcvshgawiktsilgllemeptmyhkfqlgntgittfif rhghpvltsfnstqhllt
Timeline for d5zr2c_: