Lineage for d5zr2c_ (5zr2 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890965Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 2890966Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 2891217Family c.60.1.0: automated matches [196988] (1 protein)
    not a true family
  6. 2891218Protein automated matches [196989] (16 species)
    not a true protein
  7. 2891224Species Entamoeba histolytica [TaxId:885318] [367266] (2 PDB entries)
  8. 2891229Domain d5zr2c_: 5zr2 C: [368263]
    automated match to d4ij6a_
    complexed with peg, pg4, sep, so4; mutant

Details for d5zr2c_

PDB Entry: 5zr2 (more details), 2.95 Å

PDB Description: crystal structure of phosphoserine phosphatase mutant (h9a) from entamoeba histolytica in complex with phosphoserine
PDB Compounds: (C:) Phosphoglycerate mutase family protein, putative

SCOPe Domain Sequences for d5zr2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zr2c_ c.60.1.0 (C:) automated matches {Entamoeba histolytica [TaxId: 885318]}
mtkliliragetewnllgkiqgctdieltpngiqqanevaqqikgnfdiiyssplhrali
taqkiagdkevhliegmkeipfgtweghtfeelngdinykkflsgedgcpfdstgmsias
wskknaqllldlckqnenktivcvshgawiktsilgllemeptmyhkfqlgntgittfif
rhghpvltsfnstqhllt

SCOPe Domain Coordinates for d5zr2c_:

Click to download the PDB-style file with coordinates for d5zr2c_.
(The format of our PDB-style files is described here.)

Timeline for d5zr2c_: