Lineage for d6q94f_ (6q94 F:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2449736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2450794Protein GDP-mannose 4,6-dehydratase [51759] (4 species)
  7. 2450797Species Human (Homo sapiens) [TaxId:9606] [102135] (7 PDB entries)
  8. 2450827Domain d6q94f_: 6q94 F: [368247]
    automated match to d1t2aa_
    complexed with edo, gdd, nap

Details for d6q94f_

PDB Entry: 6q94 (more details), 2.8 Å

PDB Description: crystal structure of human gdp-d-mannose 4,6-dehydratase (s156d) in complex with gdp-man
PDB Compounds: (F:) GDP-mannose 4,6 dehydratase

SCOPe Domain Sequences for d6q94f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6q94f_ c.2.1.2 (F:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]}
rnvalitgitgqdgsylaefllekgyevhgivrrsssfntgriehlyknpqahiegnmkl
hygdltdstclvkiinevkpteiynlgaqshvkisfdlaeytadvdgvgtlrlldavktc
glinsvkfyqastdelygkvqeipqkettpfyprspygaaklyaywivvnfreaynlfav
ngilfnhesprrganfvtrkisrsvakiylgqlecfslgnldakrdwghakdyveamwlm
lqndepedfviatgevhsvrefveksflhigktivwegknenevgrcketgkvhvtvdlk
yyrptevdflqgdctkakqklnwkprvafdelvremvhadvelmrtnpna

SCOPe Domain Coordinates for d6q94f_:

Click to download the PDB-style file with coordinates for d6q94f_.
(The format of our PDB-style files is described here.)

Timeline for d6q94f_: