Lineage for d1l55a_ (1l55 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2495000Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2495001Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2496244Family d.2.1.3: Phage lysozyme [53981] (4 protein domains)
  6. 2496250Protein Phage T4 lysozyme [53982] (1 species)
  7. 2496251Species Bacteriophage T4 [TaxId:10665] [53983] (572 PDB entries)
    Uniprot P00720
    many mutant structures
  8. 2496717Domain d1l55a_: 1l55 A: [36824]
    complexed with bme, cl; mutant

Details for d1l55a_

PDB Entry: 1l55 (more details), 1.9 Å

PDB Description: analysis of the interaction between charged side chains and the alpha- helix dipole using designed thermostable mutants of phage t4 lysozyme
PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d1l55a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l55a_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydslnavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk

SCOPe Domain Coordinates for d1l55a_:

Click to download the PDB-style file with coordinates for d1l55a_.
(The format of our PDB-style files is described here.)

Timeline for d1l55a_: