SCOPe 2.07: Domain d6nsfa1: 6nsf A:11-325

Lineage for d6nsfa1 (6nsf A:11-325)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (57 species)
   not a true protein

7. Species Influenza a virus [TaxId:476294] [368215] (2 PDB entries)

8. Domain d6nsfa1: 6nsf A:11-325 [368216]
   Other proteins in same PDB: d6nsfa2, d6nsfb_
   automated match to d5t0ba_
   complexed with bma, ful, man, nag, sia; mutant

Details for d6nsfa1

PDB Entry: 6nsf, 2.1 Å

PDB Description: crystal structure of the a/brisbane/10/2007 (h3n2) influenza virus hemagglutinin g186v/l194p mutant in complex with 3'-slnln

PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d6nsfa1:

Sequence; same for both SEQRES and ATOM records:

>d6nsfa1 b.19.1.0 (A:11-325) automated matches {Influenza a virus [TaxId: 476294]}
atlclghhavpngtivktitndqievtnatelvqssstgeicdsphqildgenctlidal
lgdpqcdgfqnkkwdlfverskaysncypydvpdyaslrslvassgtlefnnesfnwtgv
tqngtssacirrsnnsffsrlnwlthlkfkypalnvtmpnnekfdklyiwgvhhpvtdnd
qifpyaqasgritvstkrsqqtvipnigsrprvrnipsrisiywtivkpgdillinstgn
liaprgyfkirsgkssimrsdapigkcnsecitpngsipndkpfqnvnritygacpryvk
qntlklatgmrnvpe

Timeline for d6nsfa1:

• d6nsfa1 is new in SCOPe 2.07-stable
  
• d6nsfa1 appears in the current release, SCOPe 2.08