Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (81 species) not a true protein |
Species Pseudomonas fluorescens [TaxId:294] [368198] (4 PDB entries) |
Domain d6nfqa_: 6nfq A: [368199] automated match to d1nm4a_ complexed with cu, yt3 |
PDB Entry: 6nfq (more details), 2 Å
SCOPe Domain Sequences for d6nfqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nfqa_ b.1.18.0 (A:) automated matches {Pseudomonas fluorescens [TaxId: 294]} hahlksatpaadstvaapadlrltfsegveatftkvslskdgtevaikgletpdadkktl vvtpaaplaagnykvvwnavsvdthksngeysfkvk
Timeline for d6nfqa_: