SCOP 1.71: Domain d1l75__: 1l75 -

Lineage for d1l75__ (1l75 -)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.3: Phage lysozyme [53981] (3 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (405 PDB entries)
   many mutant structures

8. Domain d1l75__: 1l75 - [36819]
   complexed with cl, seo; mutant

Details for d1l75__

PDB Entry: 1l75, 1.9 Å

PDB Description: multiple stabilizing alanine replacements within alpha-helix 126-134 of t4 lysozyme have independent, additive effects on both structure and stability

SCOP Domain Sequences for d1l75__:

Sequence; same for both SEQRES and ATOM records:

>d1l75__ d.2.1.3 (-) Phage T4 lysozyme {Bacteriophage T4}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslrm
lqqkrwaaaaaaaaksrwynqtpnrakrvittfrtgtwdayk

Timeline for d1l75__:

• d1l75__ first appeared (with stable ids) in SCOP 1.55
  
• d1l75__ appears in SCOP 1.69
  
• d1l75__ is called d1l75a_ in SCOP 1.73
  
• d1l75__ appears in the current release, SCOPe 2.08, called d1l75a_