![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) ![]() binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
![]() | Family a.4.6.0: automated matches [191513] (1 protein) not a true family |
![]() | Protein automated matches [190858] (24 species) not a true protein |
![]() | Species Paenisporosarcina sp. [TaxId:1231057] [368172] (1 PDB entry) |
![]() | Domain d6jqsa_: 6jqs A: [368173] automated match to d2rnja_ |
PDB Entry: 6jqs (more details), 2.09 Å
SCOPe Domain Sequences for d6jqsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jqsa_ a.4.6.0 (A:) automated matches {Paenisporosarcina sp. [TaxId: 1231057]} rslltgrereifqllvrdystkdisiqlkisektvrnhisntiqklgvsgrsqailellr lgelsld
Timeline for d6jqsa_: