Lineage for d6m7gl_ (6m7g L:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574993Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2574994Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2575571Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2575572Protein automated matches [190038] (48 species)
    not a true protein
  7. 2575952Species Pseudomonas putida [TaxId:160488] [334147] (3 PDB entries)
  8. 2575972Domain d6m7gl_: 6m7g L: [368160]
    automated match to d5jtfa_
    complexed with ppq

Details for d6m7gl_

PDB Entry: 6m7g (more details), 2.66 Å

PDB Description: crystal structure of arsn, n-acetyltransferase with substrate phosphinothricin from pseudomonas putida kt2440
PDB Compounds: (L:) Phosphinothricin N-acetyltransferase

SCOPe Domain Sequences for d6m7gl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6m7gl_ d.108.1.0 (L:) automated matches {Pseudomonas putida [TaxId: 160488]}
gidirvarpedaeeiqiiyapivlntaisfeeavpsveqmreristtlqtypylvavreg
rvvgyayasqhraraayrwavdvtvyvaegqrrsgiarqlydvllpvlkrlgyrsayagi
alpnegsvglherlgfqhigtfpqvgfkldawhdvgywrfdfgdeglhpeaplgfl

SCOPe Domain Coordinates for d6m7gl_:

Click to download the PDB-style file with coordinates for d6m7gl_.
(The format of our PDB-style files is described here.)

Timeline for d6m7gl_: