Lineage for d6jtea_ (6jte A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2579367Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 2579368Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) (S)
  5. 2579369Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins)
    Family 2 zinc amidase;
  6. 2579432Protein automated matches [190549] (4 species)
    not a true protein
  7. 2579435Species Camel (Camelus dromedarius) [TaxId:9838] [188016] (40 PDB entries)
  8. 2579540Domain d6jtea_: 6jte A: [368157]
    automated match to d3ng4a_
    complexed with 6na, act, edo, gol, tla

Details for d6jtea_

PDB Entry: 6jte (more details), 2.3 Å

PDB Description: structure of the complex of peptidoglycan recognition protein, pgrp-s with compounds bound at the interface of a dimer
PDB Compounds: (A:) Peptidoglycan recognition protein 1

SCOPe Domain Sequences for d6jtea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jtea_ d.118.1.1 (A:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
cgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyhvrnlg
wcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppralraaq
nllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra

SCOPe Domain Coordinates for d6jtea_:

Click to download the PDB-style file with coordinates for d6jtea_.
(The format of our PDB-style files is described here.)

Timeline for d6jtea_:

  • d6jtea_ is new in SCOPe 2.07-stable
  • d6jtea_ does not appear in SCOPe 2.08