SCOPe 2.08: Domain d6ioyc2: 6ioy C:198-397

Lineage for d6ioyc2 (6ioy C:198-397)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (64 species)
   not a true protein

7. Species Porphyromonas gingivalis [TaxId:431947] [368132] (1 PDB entry)

8. Domain d6ioyc2: 6ioy C:198-397 [368151]
   Other proteins in same PDB: d6ioya3, d6ioyb3, d6ioyc3, d6ioyd3
   automated match to d1g99a2
   complexed with mpd, so4

Details for d6ioyc2

PDB Entry: 6ioy, 1.94 Å

PDB Description: crystal structure of porphyromonas gingivalis acetate kinase

PDB Compounds: (C:) acetate kinase

SCOPe Domain Sequences for d6ioyc2:

Sequence; same for both SEQRES and ATOM records:

>d6ioyc2 c.55.1.0 (C:198-397) automated matches {Porphyromonas gingivalis [TaxId: 431947]}
dydktriitahigngasiaaikngkaldvslgmtpveglmmgtrsgdvdpgvltflmeae
glqaagiselinkksgvlgvsgvssdlreiedaikngneratlamtmydyrikkyvgaya
aamggvdvlvftggvgenqyttrekvctdmefmgivfdskvnegmrgkemviskpeskvt
vivvptdeeymiasdtmtil

Timeline for d6ioyc2:

• d6ioyc2 first appeared in SCOPe 2.07