Lineage for d6ioyb1 (6ioy B:2-197)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2492670Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2492671Protein automated matches [226839] (63 species)
    not a true protein
  7. 2493308Species Porphyromonas gingivalis [TaxId:431947] [368132] (1 PDB entry)
  8. 2493311Domain d6ioyb1: 6ioy B:2-197 [368147]
    Other proteins in same PDB: d6ioya3, d6ioyb3, d6ioyc3, d6ioyd3
    automated match to d1g99a1
    complexed with mpd, so4

Details for d6ioyb1

PDB Entry: 6ioy (more details), 1.94 Å

PDB Description: crystal structure of porphyromonas gingivalis acetate kinase
PDB Compounds: (B:) acetate kinase

SCOPe Domain Sequences for d6ioyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ioyb1 c.55.1.0 (B:2-197) automated matches {Porphyromonas gingivalis [TaxId: 431947]}
kvlvlncgsssvkykllempkgdvlaqggveklglpgsflkltmpngekvvlekdmpeht
iavefilsvlkddkygciksyeeidavghrlvhggekfsnsveitpeviakveeciplap
lhnpanlkgvvaiekllpgirqvgvfdtaffqtmpehvyryalpydmcnkhgvrrygfhg
tshryvsaraceilgl

SCOPe Domain Coordinates for d6ioyb1:

Click to download the PDB-style file with coordinates for d6ioyb1.
(The format of our PDB-style files is described here.)

Timeline for d6ioyb1: