Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (63 species) not a true protein |
Species Porphyromonas gingivalis [TaxId:431947] [368132] (1 PDB entry) |
Domain d6ioyb1: 6ioy B:2-197 [368147] Other proteins in same PDB: d6ioya3, d6ioyb3, d6ioyc3, d6ioyd3 automated match to d1g99a1 complexed with mpd, so4 |
PDB Entry: 6ioy (more details), 1.94 Å
SCOPe Domain Sequences for d6ioyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ioyb1 c.55.1.0 (B:2-197) automated matches {Porphyromonas gingivalis [TaxId: 431947]} kvlvlncgsssvkykllempkgdvlaqggveklglpgsflkltmpngekvvlekdmpeht iavefilsvlkddkygciksyeeidavghrlvhggekfsnsveitpeviakveeciplap lhnpanlkgvvaiekllpgirqvgvfdtaffqtmpehvyryalpydmcnkhgvrrygfhg tshryvsaraceilgl
Timeline for d6ioyb1: