![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
![]() | Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) ![]() the constituent families form similar dimers |
![]() | Family c.77.1.0: automated matches [191423] (1 protein) not a true family |
![]() | Protein automated matches [190603] (24 species) not a true protein |
![]() | Species Porphyromonas gingivalis [TaxId:431947] [368117] (2 PDB entries) |
![]() | Domain d6iowa1: 6iow A:2-335 [368144] Other proteins in same PDB: d6iowa2, d6iowb2 automated match to d2af4d_ |
PDB Entry: 6iow (more details), 1.7 Å
SCOPe Domain Sequences for d6iowa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6iowa1 c.77.1.0 (A:2-335) automated matches {Porphyromonas gingivalis [TaxId: 431947]} dliqdvirraqenkqrivlpegleprtleaadrlmadkvvniilignvdsvkakvaelgl knldeaviidpnnhpkkqqytdlllqirqkkgltpekaaelvenplylgclivksgdadg liagaqnttgdvlrpalqviktapgmtsvsgtfllftkakeygkdglllvadcavipnpt adelaqiavatartakaiadieprvamlsfstkgsakhemtdkvveatrmaqemapdlli dgemqadaalvervaalkapgsnvagkanvlvfptlevgniayklverlghaeavgpilq gmaapvndlsrgcsvediyrmvaitanqaiaake
Timeline for d6iowa1: