Lineage for d6g9yb_ (6g9y B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473281Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2473282Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2474233Family c.68.1.0: automated matches [191551] (1 protein)
    not a true family
  6. 2474234Protein automated matches [190951] (33 species)
    not a true protein
  7. 3068044Species Aspergillus fumigatus [TaxId:330879] [368106] (3 PDB entries)
  8. 3068076Domain d6g9yb_: 6g9y B: [368138]
    automated match to d4bmaa_
    complexed with gn1

Details for d6g9yb_

PDB Entry: 6g9y (more details), 2.08 Å

PDB Description: crystal structure of aspergillus fumigatus udp-n-acetylglucosamine pyrophosphorylase in complex with glcnac-1p
PDB Compounds: (B:) udp-n-acetylglucosamine pyrophosphorylase

SCOPe Domain Sequences for d6g9yb_:

Sequence, based on SEQRES records: (download)

>d6g9yb_ c.68.1.0 (B:) automated matches {Aspergillus fumigatus [TaxId: 330879]}
psaeefqqlrkkytdagqghvfafvdelqtgersqlfhqlssfdpvrineladkalnppk
addgpasleplpdiatasildsdpkdleqwyeeglklvagnkvavvlmaggqgtrlgssa
pkgcfdiglpshkslfqiqaeriaklqllaqrisgkeavipwyvmtsgptrkpteeffeq
hkyfglnksdviifeqgvlpcisnegkilmeskfkvavapdgnggiyqalltsgvredmr
krgiehihtycvdnclvkvadpvfigfaaskqvdiatkvvrkrnatesvglilqkngkpd
vveyseidketaeakdpkqpdvlkfraanivnhyysfkffesielwahklphhvarkkip
cikegtgeffkpekpngikleqfvfdvfpmtplekfacievrredefsplknargtgedd
pdtskrdimsqgqrwiekaggivitegdvvgvevsplisyggegleflkgreikapafie
k

Sequence, based on observed residues (ATOM records): (download)

>d6g9yb_ c.68.1.0 (B:) automated matches {Aspergillus fumigatus [TaxId: 330879]}
psaeefqqlrkkytdagqghvfafvdelqtgersqlfhqlssfdpvrineladkalnppa
sleplpdiatasildsdpkdleqwyeeglklvagnkvavvlmaggqgtrlgssapkgcfd
iglpshkslfqiqaeriaklqllaqrisgkeavipwyvmtsgptrkpteeffeqhkyfgl
nksdviifeqgvlpcisnegkilmeskfkvavapdgnggiyqalltsgvredmrkrgieh
ihtycvdnclvkvadpvfigfaaskqvdiatkvvrkrnatesvglilqkngkpdvveyse
ifraanivnhyysfkffesielwahklphhvarkkipcikkpekpngikleqfvfdvfpm
tplekfacievrredefsplknargtgeddpdtskrdimsqgqrwiekaggivitegvgv
evsplisyggegleflkgreikapafiek

SCOPe Domain Coordinates for d6g9yb_:

Click to download the PDB-style file with coordinates for d6g9yb_.
(The format of our PDB-style files is described here.)

Timeline for d6g9yb_:

  • d6g9yb_ is new in SCOPe 2.07-stable