Lineage for d6ic7a_ (6ic7 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2806573Superfamily b.61.5: Dipeptidyl peptidase I (cathepsin C), exclusion domain [75001] (2 families) (S)
    automatically mapped to Pfam PF08773
  5. 2806574Family b.61.5.1: Dipeptidyl peptidase I (cathepsin C), exclusion domain [75002] (1 protein)
  6. 2806575Protein Dipeptidyl peptidase I (cathepsin C), exclusion domain [75003] (2 species)
  7. 2806576Species Human (Homo sapiens) [TaxId:9606] [75004] (15 PDB entries)
  8. 2806582Domain d6ic7a_: 6ic7 A: [368131]
    automated match to d1k3ba_
    complexed with cl, h9h, nag

Details for d6ic7a_

PDB Entry: 6ic7 (more details), 2 Å

PDB Description: human cathepsin-c in complex with dipeptidyl cyclopropyl nitrile inhibitor 3
PDB Compounds: (A:) Dipeptidyl peptidase 1

SCOPe Domain Sequences for d6ic7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ic7a_ b.61.5.1 (A:) Dipeptidyl peptidase I (cathepsin C), exclusion domain {Human (Homo sapiens) [TaxId: 9606]}
dtpanctyldllgtwvfqvgssgsqrdvncsvmgpqekkvvvylqkldtayddlgnsghf
tiiynqgfeivlndykwfaffkykeegskvttycnetmtgwvhdvlgrnwacftgkkv

SCOPe Domain Coordinates for d6ic7a_:

Click to download the PDB-style file with coordinates for d6ic7a_.
(The format of our PDB-style files is described here.)

Timeline for d6ic7a_: