![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
![]() | Superfamily b.61.5: Dipeptidyl peptidase I (cathepsin C), exclusion domain [75001] (2 families) ![]() automatically mapped to Pfam PF08773 |
![]() | Family b.61.5.1: Dipeptidyl peptidase I (cathepsin C), exclusion domain [75002] (1 protein) |
![]() | Protein Dipeptidyl peptidase I (cathepsin C), exclusion domain [75003] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [75004] (15 PDB entries) |
![]() | Domain d6ic7a_: 6ic7 A: [368131] automated match to d1k3ba_ complexed with cl, h9h, nag |
PDB Entry: 6ic7 (more details), 2 Å
SCOPe Domain Sequences for d6ic7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ic7a_ b.61.5.1 (A:) Dipeptidyl peptidase I (cathepsin C), exclusion domain {Human (Homo sapiens) [TaxId: 9606]} dtpanctyldllgtwvfqvgssgsqrdvncsvmgpqekkvvvylqkldtayddlgnsghf tiiynqgfeivlndykwfaffkykeegskvttycnetmtgwvhdvlgrnwacftgkkv
Timeline for d6ic7a_: